PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn132371
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family MYB_related
Protein Properties Length: 276aa    MW: 31399.3 Da    PI: 5.0318
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn132371genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.84.6e-173276147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rgr+T+eE++l++ ++   G++ W+ Ia++++ gRt++++k++w+++
       Achn132371 32 RGRFTPEEEKLIISLHGAVGNR-WAHIASHLP-GRTDNEIKNYWNSW 76
                     89********************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.17626IPR017877Myb-like domain
SuperFamilySSF466895.43E-221283IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-111238IPR009057Homeodomain-like
PROSITE profilePS5129425.5112781IPR017930Myb domain
SMARTSM007171.2E-163179IPR001005SANT/Myb domain
PfamPF002498.9E-163276IPR001005SANT/Myb domain
CDDcd001674.28E-123477No hitNo description
Gene3DG3DSA:1.10.10.604.3E-213977IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1901430Biological Processpositive regulation of syringal lignin biosynthetic process
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MDRMSSANLG LQRCGKSCRL RWINYLRPDI RRGRFTPEEE KLIISLHGAV GNRWAHIASH  60
LPGRTDNEIK NYWNSWIKKK IRKAAPPPAT KKPCTNDQHS QFNIYVSNQI DNFLNNNQDL  120
LTKPPLQDTL CSSPTPLFMF DTSGLPEGII TDGNQRRELF HDPVGLNSET WHMNQQEVQE  180
LNPTASFSMD SYYLPSLINL ESTVPMDHQV QCCGVTEERE MGLECLEREE LMNVEWVESQ  240
QCSSFLFWDQ SEGLLCGEEI APASSNTGTM LSSYP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-21138140108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002273004.11e-117PREDICTED: transcription factor MYB86
TrEMBLD7TV591e-117D7TV59_VITVI; Putative uncharacterized protein
STRINGVIT_02s0025g00320.t011e-116(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA124391722
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63910.12e-55myb domain protein 103